SCOP 1.67: Domain d1ko0a2: 1ko0 A:32-278

Lineage for d1ko0a2 (1ko0 A:32-278)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Diaminopimelate decarboxylase LysA [89457] (2 species)
   most similar to eukaryotic ODC

7. Species Escherichia coli [TaxId:562] [102048] (2 PDB entries)

8. Domain d1ko0a2: 1ko0 A:32-278 [90972]
   Other proteins in same PDB: d1ko0a1
   complexed with lys, plp

Details for d1ko0a2

PDB Entry: 1ko0, 2.2 Å

PDB Description: Crystal Structure of a D,L-lysine complex of diaminopimelate decarboxylase

SCOP Domain Sequences for d1ko0a2:

Sequence; same for both SEQRES and ATOM records:

>d1ko0a2 c.1.6.1 (A:32-278) Diaminopimelate decarboxylase LysA {Escherichia coli}
daqiirrqiaalkqfdvvrfaqkacsnihilrlmreqgvkvdsvslgeieralaagynpq
thpddivftadvidqatlervselqipvnagsvdmldqlgqvspghrvwlrvnpgfghgh
sqktntggenskhgiwytdlpaaldviqrhhlqlvgihmhigsgvdyahleqvcgamvrq
viefgqdlqaisaggglsvpyqqgeeavdtehyyglwnaareqiarhlghpvkleiepgr
flvaqsg

Timeline for d1ko0a2:

• d1ko0a2 is new in SCOP 1.67
  
• d1ko0a2 appears in SCOP 1.69
  
• d1ko0a2 appears in the current release, SCOPe 2.08