![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Diaminopimelate decarboxylase LysA [89457] (3 species) most similar to eukaryotic ODC |
![]() | Species Escherichia coli [TaxId:562] [102048] (2 PDB entries) |
![]() | Domain d1knwa2: 1knw A:32-278 [90970] Other proteins in same PDB: d1knwa1, d1knwa3 complexed with li, mes, plp, so4 |
PDB Entry: 1knw (more details), 2.1 Å
SCOPe Domain Sequences for d1knwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knwa2 c.1.6.1 (A:32-278) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]} daqiirrqiaalkqfdvvrfaqkacsnihilrlmreqgvkvdsvslgeieralaagynpq thpddivftadvidqatlervselqipvnagsvdmldqlgqvspghrvwlrvnpgfghgh sqktntggenskhgiwytdlpaaldviqrhhlqlvgihmhigsgvdyahleqvcgamvrq viefgqdlqaisaggglsvpyqqgeeavdtehyyglwnaareqiarhlghpvkleiepgr flvaqsg
Timeline for d1knwa2: