SCOPe 2.06: Domain d1knwa1: 1knw A:2-31,A:279-420

Lineage for d1knwa1 (1knw A:2-31,A:279-420)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Diaminopimelate decarboxylase LysA [89350] (3 species)

7. Species Escherichia coli [TaxId:562] [101820] (2 PDB entries)

8. Domain d1knwa1: 1knw A:2-31,A:279-420 [90969]
   Other proteins in same PDB: d1knwa2, d1knwa3
   complexed with li, mes, plp, so4

Details for d1knwa1

PDB Entry: 1knw, 2.1 Å

PDB Description: Crystal structure of diaminopimelate decarboxylase

PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1knwa1:

Sequence; same for both SEQRES and ATOM records:

>d1knwa1 b.49.2.3 (A:2-31,A:279-420) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]}
phslfstdtdltaenllrlpaefgcpvwvyXvlitqvrsvkqmgsrhfvlvdagfndlmr
pamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetralpevkag
dylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell

Timeline for d1knwa1:

• d1knwa1 first appeared in SCOP 1.67
  
• d1knwa1 appears in SCOPe 2.05
  
• d1knwa1 appears in SCOPe 2.07
  
• d1knwa1 appears in the current release, SCOPe 2.08