Lineage for d1kfkb_ (1kfk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907595Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2907621Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)
  8. 2907667Domain d1kfkb_: 1kfk B: [90961]
    Other proteins in same PDB: d1kfka_
    complexed with na, plp

Details for d1kfkb_

PDB Entry: 1kfk (more details), 2.4 Å

PDB Description: Crystal structure of Tryptophan Synthase From Salmonella Typhimurium
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1kfkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfkb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilka

SCOPe Domain Coordinates for d1kfkb_:

Click to download the PDB-style file with coordinates for d1kfkb_.
(The format of our PDB-style files is described here.)

Timeline for d1kfkb_: