Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein Tryptophan synthase, beta-subunit [53688] (4 species) |
Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries) |
Domain d1kfkb_: 1kfk B: [90961] Other proteins in same PDB: d1kfka_ complexed with na, plp |
PDB Entry: 1kfk (more details), 2.4 Å
SCOPe Domain Sequences for d1kfkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfkb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm mreqpekeqllvvnlsgrgdkdiftvhdilka
Timeline for d1kfkb_: