SCOP 1.71: Domain d1kcba2: 1kcb A:167-340

Lineage for d1kcba2 (1kcb A:167-340)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)

8. Domain d1kcba2: 1kcb A:167-340 [90952]
   complexed with cu; mutant

Details for d1kcba2

PDB Entry: 1kcb, 1.65 Å

PDB Description: crystal structure of a no-forming nitrite reductase mutant: an analog of a transition state in enzymatic reaction

SCOP Domain Sequences for d1kcba2:

Sequence; same for both SEQRES and ATOM records:

>d1kcba2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphlegghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d1kcba2:

• d1kcba2 first appeared in SCOP 1.67
  
• d1kcba2 appears in SCOP 1.69
  
• d1kcba2 appears in SCOP 1.73
  
• d1kcba2 appears in the current release, SCOPe 2.08