Lineage for d1k36a_ (1k36 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747781Protein Epiregulin, EGF-domain [103561] (1 species)
  7. 747782Species Human (Homo sapiens) [TaxId:9606] [103562] (2 PDB entries)
  8. 747783Domain d1k36a_: 1k36 A: [90931]

Details for d1k36a_

PDB Entry: 1k36 (more details)

PDB Description: nmr structure of human epiregulin
PDB Compounds: (A:) Epiregulin

SCOP Domain Sequences for d1k36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
vsitkcssdmngyclhgqciylvdmsqnycrcevgytgvrcehffl

SCOP Domain Coordinates for d1k36a_:

Click to download the PDB-style file with coordinates for d1k36a_.
(The format of our PDB-style files is described here.)

Timeline for d1k36a_: