SCOPe 2.07: Domain d1j3wa_: 1j3w A:

Lineage for d1j3wa_ (1j3w A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Giding protein MglB [103198] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry)

8. Domain d1j3wa_: 1j3w A: [90833]
   structural genomics
   complexed with mes, mg, so4

Details for d1j3wa_

PDB Entry: 1j3w, 1.5 Å

PDB Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8

PDB Compounds: (A:) Giding protein-mglB

SCOPe Domain Sequences for d1j3wa_:

Sequence; same for both SEQRES and ATOM records:

>d1j3wa_ d.110.7.1 (A:) Giding protein MglB {Thermus thermophilus [TaxId: 274]}
lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
sealariaeealan

Timeline for d1j3wa_:

• d1j3wa_ first appeared in SCOP 1.67
  
• d1j3wa_ appears in SCOPe 2.06
  
• d1j3wa_ appears in the current release, SCOPe 2.08