Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Hydroxyisobutyrate dehydrogenase [102171] (2 species) |
Species Thermus thermophilus [TaxId:274] [102172] (1 PDB entry) |
Domain d1j3vd2: 1j3v D:2-157 [90832] Other proteins in same PDB: d1j3va1, d1j3vb1, d1j3vc1, d1j3vd1 structural genomics complexed with ndp |
PDB Entry: 1j3v (more details), 1.8 Å
SCOP Domain Sequences for d1j3vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3vd2 c.2.1.6 (D:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus} ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts gaeagtltvmlggpeeavervrpflayakkvvhvgp
Timeline for d1j3vd2: