SCOPe 2.02: Domain d1j30b_: 1j30 B:

Lineage for d1j30b_ (1j30 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Hypothetical rubrerythrin [101130] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry)

8. Domain d1j30b_: 1j30 B: [90807]
   segment-swapped dimer
   complexed with fe, oxy, zn

Details for d1j30b_

PDB Entry: 1j30, 1.7 Å

PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon

PDB Compounds: (B:) 144aa long hypothetical rubrerythrin

SCOPe Domain Sequences for d1j30b_:

Sequence; same for both SEQRES and ATOM records:

>d1j30b_ a.25.1.1 (B:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkq

Timeline for d1j30b_:

• d1j30b_ first appeared in SCOP 1.67
  
• d1j30b_ appears in SCOPe 2.01
  
• d1j30b_ appears in SCOPe 2.03
  
• d1j30b_ appears in the current release, SCOPe 2.08