Lineage for d1j1bb_ (1j1b B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612217Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 612218Species Human (Homo sapiens) [TaxId:9606] [69824] (14 PDB entries)
  8. 612220Domain d1j1bb_: 1j1b B: [90759]
    complexed with anp

Details for d1j1bb_

PDB Entry: 1j1b (more details), 1.8 Å

PDB Description: Binary complex structure of human tau protein kinase I with AMPPNP

SCOP Domain Sequences for d1j1bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1bb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
riqa

SCOP Domain Coordinates for d1j1bb_:

Click to download the PDB-style file with coordinates for d1j1bb_.
(The format of our PDB-style files is described here.)

Timeline for d1j1bb_: