![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102158] (1 PDB entry) |
![]() | Domain d1j0xq1: 1j0x Q:1-148,Q:313-332 [90754] Other proteins in same PDB: d1j0xo2, d1j0xp2, d1j0xq2, d1j0xr2 |
PDB Entry: 1j0x (more details), 2.4 Å
SCOP Domain Sequences for d1j0xq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0xq1 c.2.1.3 (Q:1-148,Q:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus)} vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa psadapmfvmgvnhekydnslkivsnasXnefgysnrvvdlmvhmaske
Timeline for d1j0xq1: