SCOPe 2.07: Domain d1j0wa1: 1j0w A:9-106

Lineage for d1j0wa1 (1j0w A:9-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Downstream of tyrosine kinase 5, Dok-5 [101832] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101833] (1 PDB entry)

8. Domain d1j0wa1: 1j0w A:9-106 [90748]
   Other proteins in same PDB: d1j0wa2, d1j0wb2

Details for d1j0wa1

PDB Entry: 1j0w, 2.5 Å

PDB Description: Crystal Structure Analysis of the Dok-5 PTB Domain

PDB Compounds: (A:) downstream of tyrosine kinase 5

SCOPe Domain Sequences for d1j0wa1:

Sequence; same for both SEQRES and ATOM records:

>d1j0wa1 b.55.1.2 (A:9-106) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]}
qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiae

Timeline for d1j0wa1:

• d1j0wa1 first appeared in SCOP 1.67, called d1j0wa_
  
• d1j0wa1 appears in SCOPe 2.06
  
• d1j0wa1 appears in the current release, SCOPe 2.08