SCOP 1.67: Domain d1j0rb_: 1j0r B:

Lineage for d1j0rb_ (1j0r B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)

6. Protein Replication terminator protein (RTP) [46808] (1 species)
   contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer

7. Species Bacillus subtilis [TaxId:1423] [46809] (3 PDB entries)

8. Domain d1j0rb_: 1j0r B: [90746]
   mutant

Details for d1j0rb_

PDB Entry: 1j0r, 2.5 Å

PDB Description: crystal structure of the replication termination protein mutant c110s

SCOP Domain Sequences for d1j0rb_:

Sequence; same for both SEQRES and ATOM records:

>d1j0rb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis}
rsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhell
ddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

Timeline for d1j0rb_:

• d1j0rb_ is new in SCOP 1.67
  
• d1j0rb_ appears in SCOP 1.69
  
• d1j0rb_ appears in the current release, SCOPe 2.08