Lineage for d1j0ra_ (1j0r A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693186Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
    automatically mapped to Pfam PF02334
  6. 2693187Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 2693188Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)
  8. 2693193Domain d1j0ra_: 1j0r A: [90745]
    mutant

Details for d1j0ra_

PDB Entry: 1j0r (more details), 2.5 Å

PDB Description: crystal structure of the replication termination protein mutant c110s
PDB Compounds: (A:) Replication termination protein

SCOPe Domain Sequences for d1j0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ra_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
tgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhellddg
ilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

SCOPe Domain Coordinates for d1j0ra_:

Click to download the PDB-style file with coordinates for d1j0ra_.
(The format of our PDB-style files is described here.)

Timeline for d1j0ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j0rb_