SCOPe 2.07: Domain d1j0ga1: 1j0g A:8-92

Lineage for d1j0ga1 (1j0g A:8-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.6: BM-002-like [75362] (3 proteins)
   Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002

6. Protein Hypothetical protein 1810045k17 [102788] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [102789] (1 PDB entry)

8. Domain d1j0ga1: 1j0g A:8-92 [90740]
   Other proteins in same PDB: d1j0ga2
   structural genomics

Details for d1j0ga1

PDB Entry: 1j0g

PDB Description: solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin- like fold

PDB Compounds: (A:) Hypothetical Protein 1810045K17

SCOPe Domain Sequences for d1j0ga1:

Sequence; same for both SEQRES and ATOM records:

>d1j0ga1 d.15.1.6 (A:8-92) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]}
mskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpa
qtagnvflkhgselriiprdrvgsc

Timeline for d1j0ga1:

• d1j0ga1 first appeared in SCOP 1.67, called d1j0ga_
  
• d1j0ga1 appears in SCOPe 2.06
  
• d1j0ga1 appears in the current release, SCOPe 2.08