Lineage for d1j0ga_ (1j0g A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717504Family d.15.1.6: BM-002-like [75362] (3 proteins)
    Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002
  6. 717505Protein Hypothetical protein 1810045k17 [102788] (1 species)
  7. 717506Species Mouse (Mus musculus) [TaxId:10090] [102789] (1 PDB entry)
  8. 717507Domain d1j0ga_: 1j0g A: [90740]
    structural genomics

Details for d1j0ga_

PDB Entry: 1j0g (more details)

PDB Description: solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin- like fold
PDB Compounds: (A:) Hypothetical Protein 1810045K17

SCOP Domain Sequences for d1j0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ga_ d.15.1.6 (A:) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]}
gsegaatmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitnd
giginpaqtagnvflkhgselriiprdrvgsc

SCOP Domain Coordinates for d1j0ga_:

Click to download the PDB-style file with coordinates for d1j0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1j0ga_: