Lineage for d1j0ga1 (1j0g A:8-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933051Family d.15.1.6: BM-002-like [75362] (3 proteins)
    Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002
  6. 2933052Protein Hypothetical protein 1810045k17 [102788] (1 species)
  7. 2933053Species Mouse (Mus musculus) [TaxId:10090] [102789] (1 PDB entry)
  8. 2933054Domain d1j0ga1: 1j0g A:8-92 [90740]
    Other proteins in same PDB: d1j0ga2
    structural genomics

Details for d1j0ga1

PDB Entry: 1j0g (more details)

PDB Description: solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin- like fold
PDB Compounds: (A:) Hypothetical Protein 1810045K17

SCOPe Domain Sequences for d1j0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ga1 d.15.1.6 (A:8-92) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]}
mskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpa
qtagnvflkhgselriiprdrvgsc

SCOPe Domain Coordinates for d1j0ga1:

Click to download the PDB-style file with coordinates for d1j0ga1.
(The format of our PDB-style files is described here.)

Timeline for d1j0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j0ga2