Lineage for d1j05l_ (1j05 L:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451954Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (24 PDB entries)
  8. 451956Domain d1j05l_: 1j05 L: [90738]
    Other proteins in same PDB: d1j05b_, d1j05h_
    part of anti-CEA Fv T84.66

Details for d1j05l_

PDB Entry: 1j05 (more details), 1.5 Å

PDB Description: The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv fragment

SCOP Domain Sequences for d1j05l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j05l_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleik

SCOP Domain Coordinates for d1j05l_:

Click to download the PDB-style file with coordinates for d1j05l_.
(The format of our PDB-style files is described here.)

Timeline for d1j05l_: