Lineage for d1j05a_ (1j05 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757072Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 1757073Domain d1j05a_: 1j05 A: [90735]
    Other proteins in same PDB: d1j05b_, d1j05h_
    part of anti-CEA Fv T84.66
    complexed with gol, po4

Details for d1j05a_

PDB Entry: 1j05 (more details), 1.5 Å

PDB Description: The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv fragment
PDB Compounds: (A:) anti-CEA mAb T84.66, light chain

SCOPe Domain Sequences for d1j05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleik

SCOPe Domain Coordinates for d1j05a_:

Click to download the PDB-style file with coordinates for d1j05a_.
(The format of our PDB-style files is described here.)

Timeline for d1j05a_: