SCOP 1.75: Domain d1j05a_: 1j05 A:

Lineage for d1j05a_ (1j05 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d1j05a_: 1j05 A: [90735]
   Other proteins in same PDB: d1j05b_, d1j05h_
   part of anti-CEA Fv T84.66

Details for d1j05a_

PDB Entry: 1j05, 1.5 Å

PDB Description: The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv fragment

PDB Compounds: (A:) anti-CEA mAb T84.66, light chain

SCOP Domain Sequences for d1j05a_:

Sequence; same for both SEQRES and ATOM records:

>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleik

Timeline for d1j05a_:

• d1j05a_ first appeared in SCOP 1.67
  
• d1j05a_ appears in SCOP 1.73
  
• d1j05a_ appears in SCOPe 2.01
  
• d1j05a_ appears in the current release, SCOPe 2.08