Lineage for d1ixva_ (1ixv A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739911Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 739912Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 739913Family d.211.1.1: Ankyrin repeat [48404] (16 proteins)
  6. 739914Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species)
  7. 739915Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (2 PDB entries)
  8. 739916Domain d1ixva_: 1ixv A: [90719]

Details for d1ixva_

PDB Entry: 1ixv (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and CDK4/6
PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOP Domain Sequences for d1ixva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvda

SCOP Domain Coordinates for d1ixva_:

Click to download the PDB-style file with coordinates for d1ixva_.
(The format of our PDB-style files is described here.)

Timeline for d1ixva_: