SCOP 1.71: Domain d1ix1b_: 1ix1 B:

Lineage for d1ix1b_ (1ix1 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [75578] (4 PDB entries)

8. Domain d1ix1b_: 1ix1 B: [90713]
   complexed with antibiotic actinonin
   complexed with bb2, mha, zn

Details for d1ix1b_

PDB Entry: 1ix1, 1.85 Å

PDB Description: Crystal Structure of P.aeruginosa Peptide deformylase Complexed with Antibiotic Actinonin

SCOP Domain Sequences for d1ix1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ix1b_ d.167.1.1 (B:) Peptide deformylase {Pseudomonas aeruginosa}
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqqahh

Timeline for d1ix1b_:

• d1ix1b_ first appeared in SCOP 1.67
  
• d1ix1b_ appears in SCOP 1.69
  
• d1ix1b_ appears in SCOP 1.73
  
• d1ix1b_ appears in the current release, SCOPe 2.08, called d1ix1b1