![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins) automatically mapped to Pfam PF03652 |
![]() | Protein Hypothetical protein, YqgF homologue [102490] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102491] (1 PDB entry) |
![]() | Domain d1iv0a_: 1iv0 A: [90706] N-terminal fragment lacking the C-terminal helix |
PDB Entry: 1iv0 (more details)
SCOPe Domain Sequences for d1iv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglp lrtdlkesaqagkvlplvealrargvevelwderfttk
Timeline for d1iv0a_: