Lineage for d1iv0a_ (1iv0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397957Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
  6. 397969Protein Hypothetical protein, YqgF homologue [102490] (1 species)
  7. 397970Species Thermus thermophilus [TaxId:274] [102491] (1 PDB entry)
  8. 397971Domain d1iv0a_: 1iv0 A: [90706]
    N-terminal fragment lacking the C-terminal helix

Details for d1iv0a_

PDB Entry: 1iv0 (more details)

PDB Description: solution structure of the yqgf-family protein (n-terminal fragment)

SCOP Domain Sequences for d1iv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus}
mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglp
lrtdlkesaqagkvlplvealrargvevelwderfttk

SCOP Domain Coordinates for d1iv0a_:

Click to download the PDB-style file with coordinates for d1iv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1iv0a_: