Lineage for d1iuya_ (1iuy A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439016Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (2 proteins)
  6. 439026Protein Cullin-3 homologue [101033] (1 species)
  7. 439027Species Mouse (Mus musculus) [TaxId:10090] [101034] (1 PDB entry)
  8. 439028Domain d1iuya_: 1iuy A: [90705]

Details for d1iuya_

PDB Entry: 1iuy (more details)

PDB Description: solution structure of the cullin-3 homologue

SCOP Domain Sequences for d1iuya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus)}
maakqgesdperketrqkvdddrkheieaaivrimksrkkmqhnvlvaevtqqlkarflp
spvvikkriegliereylartpedrkvytyva

SCOP Domain Coordinates for d1iuya_:

Click to download the PDB-style file with coordinates for d1iuya_.
(The format of our PDB-style files is described here.)

Timeline for d1iuya_: