SCOPe 2.08: Domain d1istb_: 1ist B:

Lineage for d1istb_ (1ist B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry)
   3jb9 chain d is cyclophilin from fission yeast; not included because sids are not case sensitive

8. Domain d1istb_: 1ist B: [90693]

Details for d1istb_

PDB Entry: 1ist, 1.9 Å

PDB Description: crystal structure of yeast cyclophilin a, cpr1

PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1istb_:

Sequence; same for both SEQRES and ATOM records:

>d1istb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

Timeline for d1istb_:

• d1istb_ first appeared in SCOP 1.67
  
• d1istb_ appears in SCOPe 2.07