Lineage for d1isea_ (1ise A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413604Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 413629Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 413630Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 413631Protein Ribosome recycling factor, RRF [55196] (5 species)
  7. 413634Species Escherichia coli [TaxId:562] [64292] (2 PDB entries)
  8. 413636Domain d1isea_: 1ise A: [90691]
    mutant

Details for d1isea_

PDB Entry: 1ise (more details), 2.2 Å

PDB Description: Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly

SCOP Domain Sequences for d1isea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isea_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli}
isdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtved
srtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrgea
eqarvavrnvgrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkeae
lmqf

SCOP Domain Coordinates for d1isea_:

Click to download the PDB-style file with coordinates for d1isea_.
(The format of our PDB-style files is described here.)

Timeline for d1isea_: