Lineage for d1hl9b1 (1hl9 B:357-448)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556178Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein)
    glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10)
  6. 1556179Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species)
  7. 1556180Species Thermotoga maritima [TaxId:2336] [101930] (3 PDB entries)
    TM0306
  8. 1556182Domain d1hl9b1: 1hl9 B:357-448 [90652]
    Other proteins in same PDB: d1hl9a2, d1hl9b2
    complexed with fuf

Details for d1hl9b1

PDB Entry: 1hl9 (more details), 2.25 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
PDB Compounds: (B:) putative alpha-l-fucosidase

SCOPe Domain Sequences for d1hl9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl9b1 b.71.1.3 (B:357-448) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleave

SCOPe Domain Coordinates for d1hl9b1:

Click to download the PDB-style file with coordinates for d1hl9b1.
(The format of our PDB-style files is described here.)

Timeline for d1hl9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hl9b2