SCOPe 2.04: Domain d1hl8b1: 1hl8 B:357-447

Lineage for d1hl8b1 (1hl8 B:357-447)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein)
   glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10)

6. Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101930] (3 PDB entries)
   TM0306

8. Domain d1hl8b1: 1hl8 B:357-447 [90648]
   Other proteins in same PDB: d1hl8a2, d1hl8b2

Details for d1hl8b1

PDB Entry: 1hl8, 2.4 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase

PDB Compounds: (B:) putative alpha-l-fucosidase

SCOPe Domain Sequences for d1hl8b1:

Sequence; same for both SEQRES and ATOM records:

>d1hl8b1 b.71.1.3 (B:357-447) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

Timeline for d1hl8b1:

• d1hl8b1 first appeared in SCOP 1.67
  
• d1hl8b1 appears in SCOPe 2.03
  
• d1hl8b1 appears in SCOPe 2.05
  
• d1hl8b1 appears in the current release, SCOPe 2.08