Lineage for d1hl8a1 (1hl8 A:357-447)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380363Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein)
    glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10)
  6. 380364Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species)
  7. 380365Species Thermotoga maritima [TaxId:243274] [101930] (3 PDB entries)
    TM0306
  8. 380368Domain d1hl8a1: 1hl8 A:357-447 [90646]
    Other proteins in same PDB: d1hl8a2, d1hl8b2

Details for d1hl8a1

PDB Entry: 1hl8 (more details), 2.4 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase

SCOP Domain Sequences for d1hl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl8a1 b.71.1.3 (A:357-447) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOP Domain Coordinates for d1hl8a1:

Click to download the PDB-style file with coordinates for d1hl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hl8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hl8a2