Lineage for d1hkma1 (1hkm A:22-266,A:335-386)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571962Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 572056Protein Chitotriosidase [82251] (1 species)
  7. 572057Species Human (Homo sapiens) [TaxId:9606] [82252] (8 PDB entries)
  8. 572062Domain d1hkma1: 1hkm A:22-266,A:335-386 [90636]
    Other proteins in same PDB: d1hkma2
    complexed with ali, naa

Details for d1hkma1

PDB Entry: 1hkm (more details), 2.55 Å

PDB Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin

SCOP Domain Sequences for d1hkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkma1 c.1.8.5 (A:22-266,A:335-386) Chitotriosidase {Human (Homo sapiens)}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels

SCOP Domain Coordinates for d1hkma1:

Click to download the PDB-style file with coordinates for d1hkma1.
(The format of our PDB-style files is described here.)

Timeline for d1hkma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkma2