Lineage for d1hkja2 (1hkj A:267-334)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857703Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 857704Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 857825Protein Chitotriosidase [82628] (1 species)
  7. 857826Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)
  8. 857835Domain d1hkja2: 1hkj A:267-334 [90633]
    Other proteins in same PDB: d1hkja1
    complexed with ami, na1, naa

Details for d1hkja2

PDB Entry: 1hkj (more details), 2.6 Å

PDB Description: crystal structure of human chitinase in complex with methylallosamidin
PDB Compounds: (A:) chitotriosidase

SCOP Domain Sequences for d1hkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkja2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOP Domain Coordinates for d1hkja2:

Click to download the PDB-style file with coordinates for d1hkja2.
(The format of our PDB-style files is described here.)

Timeline for d1hkja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkja1