SCOP 1.67: Domain d1h3xb2: 1h3x B:342-444

Lineage for d1h3xb2 (1h3x B:342-444)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (20 PDB entries)

8. Domain d1h3xb2: 1h3x B:342-444 [90605]
   Other proteins in same PDB: d1h3xa1, d1h3xb1
   part of a Fc
   complexed with afl, bma, man, nag, ndg

Details for d1h3xb2

PDB Entry: 1h3x, 2.44 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g0f)2

SCOP Domain Sequences for d1h3xb2:

Sequence; same for both SEQRES and ATOM records:

>d1h3xb2 b.1.1.2 (B:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d1h3xb2:

• d1h3xb2 is new in SCOP 1.67
  
• d1h3xb2 appears in SCOP 1.69
  
• d1h3xb2 appears in the current release, SCOPe 2.08