Lineage for d1h3xa2 (1h3x A:342-445)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453852Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 453855Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)
  8. 453869Domain d1h3xa2: 1h3x A:342-445 [90603]
    Other proteins in same PDB: d1h3xa1, d1h3xb1

Details for d1h3xa2

PDB Entry: 1h3x (more details), 2.44 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g0f)2
PDB Compounds: (A:)

SCOP Domain Sequences for d1h3xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3xa2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOP Domain Coordinates for d1h3xa2:

Click to download the PDB-style file with coordinates for d1h3xa2.
(The format of our PDB-style files is described here.)

Timeline for d1h3xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3xa1