Lineage for d1h2ba1 (1h2b A:17-154,A:327-359)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785507Species Aeropyrum pernix [TaxId:56636] [101701] (1 PDB entry)
  8. 2785508Domain d1h2ba1: 1h2b A:17-154,A:327-359 [90543]
    Other proteins in same PDB: d1h2ba2, d1h2bb2
    complexed with naj, oca, zn

Details for d1h2ba1

PDB Entry: 1h2b (more details), 1.62 Å

PDB Description: crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1h2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Aeropyrum pernix [TaxId: 56636]}
kaarlheynkplriedvdyprlegrfdvivriagagvchtdlhlvqgmwhellqpklpyt
lghenvgyieevaegveglekgdpvilhpavtdgtclacragedmhcenlefpglnidgg
faefmrtshrsviklpkdXvrvevdihkldeindvlerlekgevlgravlip

SCOPe Domain Coordinates for d1h2ba1:

Click to download the PDB-style file with coordinates for d1h2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1h2ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h2ba2