Lineage for d1gzwa_ (1gzw A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556305Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 556322Protein Galectin-1 [100925] (4 species)
  7. 556339Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries)
  8. 556342Domain d1gzwa_: 1gzw A: [90535]

Details for d1gzwa_

PDB Entry: 1gzw (more details), 1.7 Å

PDB Description: x-ray crystal structure of human galectin-1

SCOP Domain Sequences for d1gzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzwa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens)}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOP Domain Coordinates for d1gzwa_:

Click to download the PDB-style file with coordinates for d1gzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1gzwa_: