Lineage for d1xoba_ (1xob A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876317Domain d1xoba_: 1xob A: [90400]

Details for d1xoba_

PDB Entry: 1xob (more details)

PDB Description: thioredoxin (reduced dithio form), nmr, 20 structures
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1xoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoba_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d1xoba_:

Click to download the PDB-style file with coordinates for d1xoba_.
(The format of our PDB-style files is described here.)

Timeline for d1xoba_: