Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Tyrosine-protein kinase zap-70 [89996] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries) |
Domain d1m61a2: 1m61 A:133-256 [90399] complexed with po4 |
PDB Entry: 1m61 (more details), 2.5 Å
SCOPe Domain Sequences for d1m61a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m61a2 d.93.1.1 (A:133-256) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke acpn
Timeline for d1m61a2: