Lineage for d1m61a1 (1m61 A:1-132)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415905Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 415906Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 415907Family d.93.1.1: SH2 domain [55551] (28 proteins)
  6. 416174Protein Tyrosine-protein kinase zap-70 [89996] (1 species)
  7. 416175Species Human (Homo sapiens) [TaxId:9606] [89997] (1 PDB entry)
  8. 416176Domain d1m61a1: 1m61 A:1-132 [90398]

Details for d1m61a1

PDB Entry: 1m61 (more details), 2.5 Å

PDB Description: crystal structure of the apo sh2 domains of zap-70

SCOP Domain Sequences for d1m61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m61a1 d.93.1.1 (A:1-132) Tyrosine-protein kinase zap-70 {Human (Homo sapiens)}
mpdpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfhhfp
ierqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdclrd
amvrdyvrqtwk

SCOP Domain Coordinates for d1m61a1:

Click to download the PDB-style file with coordinates for d1m61a1.
(The format of our PDB-style files is described here.)

Timeline for d1m61a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m61a2