Lineage for d1lj8a4 (1lj8 A:2-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845108Protein Mannitol 2-dehydrogenase [82301] (1 species)
  7. 2845109Species Pseudomonas fluorescens [TaxId:294] [82302] (2 PDB entries)
  8. 2845110Domain d1lj8a4: 1lj8 A:2-286 [90393]
    Other proteins in same PDB: d1lj8a3, d1lj8a5
    complexed with nad

Details for d1lj8a4

PDB Entry: 1lj8 (more details), 1.7 Å

PDB Description: Crystal structure of mannitol dehydrogenase in complex with NAD
PDB Compounds: (A:) mannitol dehydrogenase

SCOPe Domain Sequences for d1lj8a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj8a4 c.2.1.6 (A:2-286) Mannitol 2-dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
klnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsic
gvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidklas
peirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraagi
paftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstahr
lqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftd

SCOPe Domain Coordinates for d1lj8a4:

Click to download the PDB-style file with coordinates for d1lj8a4.
(The format of our PDB-style files is described here.)

Timeline for d1lj8a4: