![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
![]() | Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [75461] (3 PDB entries) |
![]() | Domain d1kska4: 1ksk A:60-231 [90389] Other proteins in same PDB: d1kska3 complexed with mse, ura |
PDB Entry: 1ksk (more details), 2 Å
SCOP Domain Sequences for d1kska4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kska4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]} pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv
Timeline for d1kska4: