Lineage for d1k8wa5 (1k8w A:9-250)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423589Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 423590Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 423596Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 423597Protein Pseudouridine synthase II TruB [69747] (3 species)
  7. 423598Species Escherichia coli [TaxId:562] [69748] (2 PDB entries)
  8. 423599Domain d1k8wa5: 1k8w A:9-250 [90388]
    Other proteins in same PDB: d1k8wa3
    complexed with fhu, so4; mutant

Details for d1k8wa5

PDB Entry: 1k8w (more details), 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA

SCOP Domain Sequences for d1k8wa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8wa5 d.265.1.2 (A:9-250) Pseudouridine synthase II TruB {Escherichia coli}
mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
lldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysa
lkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlg
eklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspa
sd

SCOP Domain Coordinates for d1k8wa5:

Click to download the PDB-style file with coordinates for d1k8wa5.
(The format of our PDB-style files is described here.)

Timeline for d1k8wa5:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8wa3