Lineage for d1k1sa2 (1k1s A:1-239)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424812Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (2 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 424813Protein DinB homolog (DBH) [100889] (2 species)
  7. 424814Species Archaeon Sulfolobus solfataricus [TaxId:2287] [100891] (3 PDB entries)
  8. 424816Domain d1k1sa2: 1k1s A:1-239 [90387]
    Other proteins in same PDB: d1k1sa1
    mutant

Details for d1k1sa2

PDB Entry: 1k1s (more details), 2.8 Å

PDB Description: Crystal Structure of DinB from Sulfolobus solfataricus

SCOP Domain Sequences for d1k1sa2:

Sequence, based on SEQRES records: (download)

>d1k1sa2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus}
mivifvdfdyffaqveevlnpqykgkplvvsvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

Sequence, based on observed residues (ATOM records): (download)

>d1k1sa2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus}
mivifvdfdyffaqveevlnpqykgkplvvsvysgtsgavatanyearklgvkagmpiik
amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

SCOP Domain Coordinates for d1k1sa2:

Click to download the PDB-style file with coordinates for d1k1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1k1sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k1sa1