Lineage for d1k1sa1 (1k1s A:240-344)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423348Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 423349Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 423350Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (3 proteins)
  6. 423351Protein DinB homolog (DBH) [100881] (2 species)
  7. 423352Species Archaeon Sulfolobus solfataricus [TaxId:2287] [100883] (2 PDB entries)
  8. 423353Domain d1k1sa1: 1k1s A:240-344 [90386]
    Other proteins in same PDB: d1k1sa2
    mutant

Details for d1k1sa1

PDB Entry: 1k1s (more details), 2.8 Å

PDB Description: Crystal Structure of DinB from Sulfolobus solfataricus

SCOP Domain Sequences for d1k1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1sa1 d.240.1.1 (A:240-344) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus}
nkskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskg
kkfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOP Domain Coordinates for d1k1sa1:

Click to download the PDB-style file with coordinates for d1k1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1k1sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k1sa2