Lineage for d1jxla1 (1jxl A:241-341)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423348Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 423349Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 423350Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (3 proteins)
  6. 423351Protein DinB homolog (DBH) [100881] (2 species)
  7. 423356Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)
  8. 423363Domain d1jxla1: 1jxl A:241-341 [90380]
    Other proteins in same PDB: d1jxla2
    complexed with bro, ca, dg3, edo, mg

Details for d1jxla1

PDB Entry: 1jxl (more details), 2.1 Å

PDB Description: Crystal Structure of a Y-Family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide

SCOP Domain Sequences for d1jxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxla1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1jxla1:

Click to download the PDB-style file with coordinates for d1jxla1.
(The format of our PDB-style files is described here.)

Timeline for d1jxla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxla2