SCOP 1.71: Domain d1jx4a1: 1jx4 A:241-341

Lineage for d1jx4a1 (1jx4 A:241-341)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)

8. Domain d1jx4a1: 1jx4 A:241-341 [90378]
   Other proteins in same PDB: d1jx4a2
   complexed with adi, ca, mg

Details for d1jx4a1

PDB Entry: 1jx4, 1.7 Å

PDB Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide

SCOP Domain Sequences for d1jx4a1:

Sequence; same for both SEQRES and ATOM records:

>d1jx4a1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d1jx4a1:

• d1jx4a1 first appeared in SCOP 1.67
  
• d1jx4a1 appears in SCOP 1.69
  
• d1jx4a1 appears in SCOP 1.73
  
• d1jx4a1 appears in the current release, SCOPe 2.08