Lineage for d1jx4a1 (1jx4 A:241-341)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564907Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2564908Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2564909Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2564910Protein DinB homolog (DBH) [100881] (3 species)
  7. 2564919Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)
  8. 2564920Domain d1jx4a1: 1jx4 A:241-341 [90378]
    Other proteins in same PDB: d1jx4a2
    protein/DNA complex; complexed with adi, ca, mg

Details for d1jx4a1

PDB Entry: 1jx4 (more details), 1.7 Å

PDB Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide
PDB Compounds: (A:) DNA polymerase IV (family Y)

SCOPe Domain Sequences for d1jx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx4a1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d1jx4a1:

Click to download the PDB-style file with coordinates for d1jx4a1.
(The format of our PDB-style files is described here.)

Timeline for d1jx4a1: