Lineage for d1jihb1 (1jih B:390-509)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423348Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 423349Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 423350Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (3 proteins)
  6. 423375Protein DNA polymerase eta [100884] (1 species)
  7. 423376Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100885] (1 PDB entry)
  8. 423378Domain d1jihb1: 1jih B:390-509 [90376]
    Other proteins in same PDB: d1jiha2, d1jihb2

Details for d1jihb1

PDB Entry: 1jih (more details), 2.25 Å

PDB Description: Yeast DNA Polymerase ETA

SCOP Domain Sequences for d1jihb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jihb1 d.240.1.1 (B:390-509) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae)}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

SCOP Domain Coordinates for d1jihb1:

Click to download the PDB-style file with coordinates for d1jihb1.
(The format of our PDB-style files is described here.)

Timeline for d1jihb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jihb2