Lineage for d1jihb1 (1jih B:390-509)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008470Protein DNA polymerase eta [100884] (1 species)
  7. 3008471Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100885] (2 PDB entries)
  8. 3008473Domain d1jihb1: 1jih B:390-509 [90376]
    Other proteins in same PDB: d1jiha2, d1jihb2

Details for d1jihb1

PDB Entry: 1jih (more details), 2.25 Å

PDB Description: Yeast DNA Polymerase ETA
PDB Compounds: (B:) DNA Polymerase ETA

SCOPe Domain Sequences for d1jihb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jihb1 d.240.1.1 (B:390-509) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

SCOPe Domain Coordinates for d1jihb1:

Click to download the PDB-style file with coordinates for d1jihb1.
(The format of our PDB-style files is described here.)

Timeline for d1jihb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jihb2