Lineage for d1jeyb2 (1jey B:6-241)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399192Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 399193Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 399298Family c.62.1.4: Ku80 subunit N-terminal domain [100962] (1 protein)
  6. 399299Protein Ku80 subunit N-terminal domain [100963] (1 species)
  7. 399300Species Human (Homo sapiens) [TaxId:9606] [100964] (2 PDB entries)
  8. 399301Domain d1jeyb2: 1jey B:6-241 [90373]
    Other proteins in same PDB: d1jeya1, d1jeya2, d1jeyb1

Details for d1jeyb2

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna

SCOP Domain Sequences for d1jeyb2:

Sequence, based on SEQRES records: (download)

>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgdgpfrl
gghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkie

Sequence, based on observed residues (ATOM records): (download)

>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslggpfrlgghgpsfplk
giteqqkegleivkmvmislegedgldeiysfseslrklcvfkkie

SCOP Domain Coordinates for d1jeyb2:

Click to download the PDB-style file with coordinates for d1jeyb2.
(The format of our PDB-style files is described here.)

Timeline for d1jeyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jeyb1